Crystal structure of e. faecalis dna binding domain liar wild type complexed with 22bp dna
PDB DOI: 10.2210/pdb4wuh/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Enterococcus Faecalis S613 , Synthetic Construct
Deposited: 2014-10-31 Deposition Author(s): Davlieva, M. , Shamoo, Y.
Crystal structure of e. faecalis dna binding domain liar wild type complexed with 22bp dna
Primary Citation of Related Structures: 4WUH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Response regulator receiver domain protein | A | 68 | Enterococcus Faecalis S613 , Synthetic Construct | MVLHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLDVDNRTQAAIYAFQHGLAK |
Response regulator receiver domain protein | B | 68 | Enterococcus Faecalis S613 , Synthetic Construct | MVLHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLDVDNRTQAAIYAFQHGLAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-10-31 Deposition Author(s): Davlieva, M. , Shamoo, Y.