Crystal structure of the dna binding domains of wild type liar from e. faecalis
PDB DOI: 10.2210/pdb4wsz/pdb
Classification: DNA BINDING PROTEIN Organism(s): N.A.
Deposited: 2014-10-29 Deposition Author(s): Davlieva, M. , Shamoo, Y.
Crystal structure of the dna binding domains of wild type liar from e. faecalis
Primary Citation of Related Structures: 4WSZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Response regulator receiver domain protein | A | 68 | N.A. | MVLHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLDVDDRTQAAIYAFQHGLAK |
| Response regulator receiver domain protein | B | 68 | N.A. | MVLHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLDVDDRTQAAIYAFQHGLAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-10-29 Deposition Author(s): Davlieva, M. , Shamoo, Y.