Crystal structure of a isoprenoid synthase family member from thermotoga neapolitana dsm 4359, target efi-509458
PDB DOI: 10.2210/pdb4wk5/pdb
Classification: TRANSFERASE Organism(s): Thermotoga Neapolitana
Deposited: 2014-10-01 Deposition Author(s): Al Obaidi, N.F. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hillerich, B. , Love, J. , Morisco, L.L. , Poulter, C.D. , Scott Glenn, A. , Seidel, R.D. , Sojitra, S. , Stead, M. , Toro, R. , Vetting, M.W. , Washington, E. , Wasserman, S.R. , Whalen, K.L.
Crystal structure of a isoprenoid synthase family member from thermotoga neapolitana dsm 4359, target efi-509458
Al Obaidi, N.F. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hillerich, B. , Love, J. , Morisco, L.L. , Poulter, C.D. , Scott Glenn, A. , Seidel, R.D. , Sojitra, S. , Stead, M. , Toro, R. , Vetting, M.W. , Washington, E. , Wasserman, S.R. , Whalen, K.L.
Primary Citation of Related Structures: 4WK5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Geranyltranstransferase | A | 294 | Thermotoga Neapolitana | MHHHHHHSSGVDLGTENLYFQSMKKETIERRIEELVKPHFNLLTESAMQYSVTAGGKRIRPLLVLTVGEDIGVEEERLVDVAVAVELFHTASLVHDDLPPIDNADFRRGKPSCHRAYGEGIALLAGDGLFFLAFSQIAKVREPKLFEEFSETAYKLLLGEAMDVEFERQEKEISVEMVEKMYSFKTGALFAFCFSAPFLLKGLDHTFVKKLGEKFGVAFQIYDDLKDVLGSLEKLGKDVGKDVKKVTLVKKMGVQKAKQLADKYYEEVLEALESEGLHRTFDFLRNLKKMVEER |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-10-01 Deposition Author(s): Al Obaidi, N.F. , Almo, S.C. , Bhosle, R. , Chowdhury, S. , Enzyme Function Initiative (Efi) , Evans, B. , Gerlt, J.A. , Hillerich, B. , Love, J. , Morisco, L.L. , Poulter, C.D. , Scott Glenn, A. , Seidel, R.D. , Sojitra, S. , Stead, M. , Toro, R. , Vetting, M.W. , Washington, E. , Wasserman, S.R. , Whalen, K.L.