Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc (wild-type)
PDB DOI: 10.2210/pdb4wi2/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2014-09-25 Deposition Author(s): Burvenich, I.J.G. , Farrugia, W. , Ramsland, P.A. , Scott, A.M.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Structural mapping of the human igg1 binding site for fcrn: hu3s193 fc (wild-type)
Burvenich, I.J.G. , Farrugia, W. , Ramsland, P.A. , Scott, A.M.
Primary Citation of Related Structures: 4WI2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ig gamma-1 chain C region | A | 208 | Homo Sapiens | GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS |
| Ig gamma-1 chain C region | B | 208 | Homo Sapiens | GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-09-25 Deposition Author(s): Burvenich, I.J.G. , Farrugia, W. , Ramsland, P.A. , Scott, A.M.