Room-temperature crystal structure of lysozyme determined by serial synchrotron crystallography using a nano focused beam.
PDB DOI: 10.2210/pdb4wg7/pdb
Classification: HYDROLASE Organism(s): Gallus Gallus
Deposited: 2014-09-18 Deposition Author(s): Brewster, A.S. , Burghammer, M. , Colletier, J.P. , Coquelle, N. , Kappe, U. , Shilova, A. , Weinhausen, B.
Room-temperature crystal structure of lysozyme determined by serial synchrotron crystallography using a nano focused beam.
Brewster, A.S. , Burghammer, M. , Colletier, J.P. , Coquelle, N. , Kappe, U. , Shilova, A. , Weinhausen, B.
Primary Citation of Related Structures: 4WG7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lysozyme C | A | 147 | Gallus Gallus | MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-09-18 Deposition Author(s): Brewster, A.S. , Burghammer, M. , Colletier, J.P. , Coquelle, N. , Kappe, U. , Shilova, A. , Weinhausen, B.