The binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna
PDB DOI: 10.2210/pdb4wcg/pdb
Classification: DNA BINDING PROTEIN Organism(s): Human Astrovirus 1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-09-04 Deposition Author(s): Athanasiadis, A. , Kus, K.
The binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna
Primary Citation of Related Structures: 4WCG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ORF112 | A | 98 | Human Astrovirus 1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMASMSVDDLDGLDGAEKVKTTASEAIPALPRLNPISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRKHPQHPVWYLPA |
ORF112 | B | 98 | Human Astrovirus 1 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMASMSVDDLDGLDGAEKVKTTASEAIPALPRLNPISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRKHPQHPVWYLPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-09-04 Deposition Author(s): Athanasiadis, A. , Kus, K.