Crystal structure of the mirror-image l-rna/l-dna aptamer nox-d20 in complex with mouse c5a-desarg complement anaphylatoxin
PDB DOI: 10.2210/pdb4wb3/pdb
Classification: DNA-RNA HYBRID Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2014-09-02 Deposition Author(s): Andersen, G.R. , Hoehlig, K. , Klussmann, S. , Maasch, C. , Vater, A. , Yatime, L.
Crystal structure of the mirror-image l-rna/l-dna aptamer nox-d20 in complex with mouse c5a-desarg complement anaphylatoxin
Andersen, G.R. , Hoehlig, K. , Klussmann, S. , Maasch, C. , Vater, A. , Yatime, L.
Primary Citation of Related Structures: 4WB3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Complement C5 | A | 78 | Mus Musculus , Synthetic Construct | GANLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLG |
| Complement C5 | B | 78 | Mus Musculus , Synthetic Construct | GANLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLG |
| Complement C5 | C | 78 | Mus Musculus , Synthetic Construct | GANLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLG |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-09-02 Deposition Author(s): Andersen, G.R. , Hoehlig, K. , Klussmann, S. , Maasch, C. , Vater, A. , Yatime, L.