Dimeric bap29 vded with disulfide bonds in crystal contacts
PDB DOI: 10.2210/pdb4w7y/pdb
Classification: TRANSPORT PROTEIN Organism(s): Salmonella Enterica
Deposited: 2014-08-22 Deposition Author(s): Quistgaard, E.M.
Dimeric bap29 vded with disulfide bonds in crystal contacts
Primary Citation of Related Structures: 4W7Y
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
B-cell receptor-associated protein 29 | A | 64 | Salmonella Enterica | SMDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSEL |
B-cell receptor-associated protein 29 | B | 64 | Salmonella Enterica | SMDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSEL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-08-22 Deposition Author(s): Quistgaard, E.M.