4UP0
Ternary crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a h3k4me2 peptide
PDB DOI: 10.2210/pdb4up0/pdb
Classification: TRANSCRIPTION Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-06-11 Deposition Author(s): Bienz, M. , Birchall, K. , Chugh, J. , Fiedler, M. , Miller, T.C.R. , Rutherford, T.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.28 Å
Ternary crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a h3k4me2 peptide
Bienz, M. , Birchall, K. , Chugh, J. , Fiedler, M. , Miller, T.C.R. , Rutherford, T.J.
Primary Citation of Related Structures: 4UP0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN | A | 99 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEGSGSGSGSVYVFTTHLANTAAEAVLQGRADSILAYHQ |
| HISTONE H3.1 | F | 15 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTGGKA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-11 Deposition Author(s): Bienz, M. , Birchall, K. , Chugh, J. , Fiedler, M. , Miller, T.C.R. , Rutherford, T.J.