4UNO
Crystal structure of the ets domain of human etv5 in complex with dna
PDB DOI: 10.2210/pdb4uno/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-05-29 Deposition Author(s): Aitkenhead, H. , Arrowsmith, C.H. , Bountra, C. , Burgess-Brown, N. , Cooper, C.D.O. , Edwards, A. , Fitzpatrick, F. , Gileadi, O. , Kopec, J. , Newman, J.A. , Pinkas, D.M. , Shrestha, L. , Tallant, C. , Von Delft, F.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal structure of the ets domain of human etv5 in complex with dna
Aitkenhead, H. , Arrowsmith, C.H. , Bountra, C. , Burgess-Brown, N. , Cooper, C.D.O. , Edwards, A. , Fitzpatrick, F. , Gileadi, O. , Kopec, J. , Newman, J.A. , Pinkas, D.M. , Shrestha, L. , Tallant, C. , Von Delft, F.
Primary Citation of Related Structures: 4UNO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ETS TRANSLOCATION VARIANT 5 | A | 100 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDN |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-05-29 Deposition Author(s): Aitkenhead, H. , Arrowsmith, C.H. , Bountra, C. , Burgess-Brown, N. , Cooper, C.D.O. , Edwards, A. , Fitzpatrick, F. , Gileadi, O. , Kopec, J. , Newman, J.A. , Pinkas, D.M. , Shrestha, L. , Tallant, C. , Von Delft, F.