4U1P
Human fyn-sh2 domain in complex with a synthetic high-affinity phospho-peptide
PDB DOI: 10.2210/pdb4u1p/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-07-16 Deposition Author(s): Garcia-Pino, A. , Huculeci, R. , Lenaerts, T. , Van Nuland, N.A.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.4 Å
Human fyn-sh2 domain in complex with a synthetic high-affinity phospho-peptide
Garcia-Pino, A. , Huculeci, R. , Lenaerts, T. , Van Nuland, N.A.J.
Primary Citation of Related Structures: 4U1P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase Fyn | A | 122 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSSGLVPRGSHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHK |
| Middle T antigen | B | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EPQYEEIPIYL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-07-16 Deposition Author(s): Garcia-Pino, A. , Huculeci, R. , Lenaerts, T. , Van Nuland, N.A.J.