Crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna
PDB DOI: 10.2210/pdb4u0y/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct
Deposited: 2014-07-14 Deposition Author(s): Fillenberg, S.B. , Muller, Y.A.
Method: X-RAY DIFFRACTION Resolution: 1.91 Å
Crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna
Fillenberg, S.B. , Muller, Y.A.
Primary Citation of Related Structures: 4U0Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTH-type transcriptional repressor YvoA | A | 78 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | GSHMNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVS |
| HTH-type transcriptional repressor YvoA | B | 78 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | GSHMNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVS |
| HTH-type transcriptional repressor YvoA | C | 78 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | GSHMNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVS |
| HTH-type transcriptional repressor YvoA | D | 78 | Bacillus Subtilis Subsp. Subtilis Str. 168 , Synthetic Construct | GSHMNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNEGLLYRLKGRGTFVS |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-07-14 Deposition Author(s): Fillenberg, S.B. , Muller, Y.A.