Staphylococcus aureus dihydrofolate reductase complexed with nadph and 6-ethyl-5-[(3s)-3-[3-methoxy-5-(pyridin-4-yl)phenyl]but-1-yn-1-yl]pyrimidine-2,4-diamine (ucp1062)
PDB DOI: 10.2210/pdb4tu5/pdb
Classification: OXIDOREDUCTASE/OXIDOREDUCTASE Inhibitor Organism(s): Staphylococcus Aureus
Deposited: 2014-06-23 Deposition Author(s): Anderson, A.C. , Reeve, S.M.
Staphylococcus aureus dihydrofolate reductase complexed with nadph and 6-ethyl-5-[(3s)-3-[3-methoxy-5-(pyridin-4-yl)phenyl]but-1-yn-1-yl]pyrimidine-2,4-diamine (ucp1062)
Primary Citation of Related Structures: 4TU5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dihydrofolate reductase | X | 157 | Staphylococcus Aureus | TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-23 Deposition Author(s): Anderson, A.C. , Reeve, S.M.