Crystal structure of atad2a bromodomain complexed with 3-(3,5-dimethyl-1,2-oxazol-4-yl)-5-[(phenylsulfonyl)amino]benzoicacid
PDB DOI: 10.2210/pdb4tu4/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens
Deposited: 2014-06-23 Deposition Author(s): Andersen, J. , Bardenhagen, J. , Cardozo, M. , Geck Do, M. , Jones, P. , Ladbury, J. , Lee, G. , Leo, E. , Leonard, P. , Palmer, W. , Petrocchi, A. , Poncet-Montange, G. , Shi, X. , Zhan, Y.
Crystal structure of atad2a bromodomain complexed with 3-(3,5-dimethyl-1,2-oxazol-4-yl)-5-[(phenylsulfonyl)amino]benzoicacid
Andersen, J. , Bardenhagen, J. , Cardozo, M. , Geck Do, M. , Jones, P. , Ladbury, J. , Lee, G. , Leo, E. , Leonard, P. , Palmer, W. , Petrocchi, A. , Poncet-Montange, G. , Shi, X. , Zhan, Y.
Primary Citation of Related Structures: 4TU4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATPase family AAA domain-containing protein 2 | A | 130 | Homo Sapiens | SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-23 Deposition Author(s): Andersen, J. , Bardenhagen, J. , Cardozo, M. , Geck Do, M. , Jones, P. , Ladbury, J. , Lee, G. , Leo, E. , Leonard, P. , Palmer, W. , Petrocchi, A. , Poncet-Montange, G. , Shi, X. , Zhan, Y.