Crystal structure of atad2a bromodomain complexed with h3(1-21)k14ac peptide
PDB DOI: 10.2210/pdb4tt4/pdb
Classification: GENE REGULATION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-06-19 Deposition Author(s): Andersen, J. , Bardenhagen, J. , Cardozo, M. , Geck Do, M. , Jones, P. , Ladbury, J. , Lee, G. , Leo, E. , Leonard, P. , Palmer, W. , Petrocchi, A. , Poncet-Montange, G. , Shi, X. , Zhan, Y.
Method: X-RAY DIFFRACTION Resolution: 2.7 Å
Crystal structure of atad2a bromodomain complexed with h3(1-21)k14ac peptide
Andersen, J. , Bardenhagen, J. , Cardozo, M. , Geck Do, M. , Jones, P. , Ladbury, J. , Lee, G. , Leo, E. , Leonard, P. , Palmer, W. , Petrocchi, A. , Poncet-Montange, G. , Shi, X. , Zhan, Y.
Primary Citation of Related Structures: 4TT4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ATPase family AAA domain-containing protein 2 | A | 130 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR |
ATPase family AAA domain-containing protein 2 | B | 130 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR |
Histone H3(1-21)K4Ac | P | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | STGGK |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-19 Deposition Author(s): Andersen, J. , Bardenhagen, J. , Cardozo, M. , Geck Do, M. , Jones, P. , Ladbury, J. , Lee, G. , Leo, E. , Leonard, P. , Palmer, W. , Petrocchi, A. , Poncet-Montange, G. , Shi, X. , Zhan, Y.