Crystal structure of whsc1l1-pwwp2
PDB DOI: 10.2210/pdb4rxj/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2014-12-11 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Li, Y. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Tempel, W.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of whsc1l1-pwwp2
Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Li, Y. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 4RXJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase NSD3 | A | 113 | Homo Sapiens | GKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIE |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-12-11 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Li, Y. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Tempel, W.