Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide app12
PDB DOI: 10.2210/pdb4rty/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2014-11-16 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.
Method: X-RAY DIFFRACTION Resolution: 1.279 Å
Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide app12
Bacarizo, J. , Camara-Artigas, A.
Primary Citation of Related Structures: 4RTY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD |
APP12 peptide | B | 13 | Gallus Gallus , Synthetic Construct | XAPPLPPRNRPRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-16 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.