Crystal structure of the src tyrosine kinase sh3 domain t96g/q128r mutant
PDB DOI: 10.2210/pdb4rtx/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus
Deposited: 2014-11-16 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the src tyrosine kinase sh3 domain t96g/q128r mutant
Primary Citation of Related Structures: 4RTX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus | GSHMTFVALYDYESRGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| Proto-oncogene tyrosine-protein kinase Src | B | 61 | Gallus Gallus | GSHMTFVALYDYESRGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| Proto-oncogene tyrosine-protein kinase Src | C | 61 | Gallus Gallus | GSHMTFVALYDYESRGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| Proto-oncogene tyrosine-protein kinase Src | D | 61 | Gallus Gallus | GSHMTFVALYDYESRGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-16 Deposition Author(s): Camara-Artigas, A.