4RTV
Crystal structure of the src tyrosine kinase sh3 domain s94a/q128r mutant in complex with the high affinity synthetic peptide app12
PDB DOI: 10.2210/pdb4rtv/pdb
Classification: PROTEIN BINDING, SIGNALING PROTEIN Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2014-11-16 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.37 Å
Crystal structure of the src tyrosine kinase sh3 domain s94a/q128r mutant in complex with the high affinity synthetic peptide app12
Bacarizo, J. , Camara-Artigas, A.
Primary Citation of Related Structures: 4RTV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYEARTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| APP12 peptide | B | 13 | Gallus Gallus , Synthetic Construct | XAPPLPPRNRPRL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-16 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.