Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t96g/q128r mutant
PDB DOI: 10.2210/pdb4rtu/pdb
Classification: PROTEIN BINDING, SIGNALING PROTEIN Organism(s): Gallus Gallus
Deposited: 2014-11-16 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.
Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t96g/q128r mutant
Bacarizo, J. , Camara-Artigas, A.
Primary Citation of Related Structures: 4RTU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus | GSHMTFVALYDYESRGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-16 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.