E129a mutant of n-terminal editing domain of threonyl-trna synthetase from aeropyrum pernix with l-ser3aa
PDB DOI: 10.2210/pdb4rrl/pdb
Classification: LIGASE Organism(s): Aeropyrum Pernix K1
Deposited: 2014-11-06 Deposition Author(s): Ahmad, S. , Sankaranarayanan, R. , Yerabham, A.S.K.
E129a mutant of n-terminal editing domain of threonyl-trna synthetase from aeropyrum pernix with l-ser3aa
Ahmad, S. , Sankaranarayanan, R. , Yerabham, A.S.K.
Primary Citation of Related Structures: 4RRL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable threonine--tRNA ligase 2 | A | 136 | Aeropyrum Pernix K1 | MRLLYLHADRFEYKTVKPALKNPPDPPGEASFGEALVVFTTVEDGDGPQTVMYAASDIASHSSRLKVTTVILYPYAHLSSRLAKPMAAHKRLIELEGALRTKFPGHVHRAPFGWYKSFSIACKGHPLAALSRSFTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-11-06 Deposition Author(s): Ahmad, S. , Sankaranarayanan, R. , Yerabham, A.S.K.