Crystal structure of ww3 domain of itch in complex with txnip peptide
PDB DOI: 10.2210/pdb4rof/pdb
Classification: LIGASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-10-28 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Crystal structure of ww3 domain of itch in complex with txnip peptide
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 4ROF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase Itchy homolog | A | 47 | Homo Sapiens , Synthetic Construct | GRRASVELPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQ |
| E3 ubiquitin-protein ligase Itchy homolog | B | 47 | Homo Sapiens , Synthetic Construct | GRRASVELPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQ |
| Thioredoxin-interacting protein | C | 14 | Homo Sapiens , Synthetic Construct | XTPEAPPCYMDVIX |
| Thioredoxin-interacting protein | D | 14 | Homo Sapiens , Synthetic Construct | XTPEAPPCYMDVIX |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-10-28 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.