Crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+-feoab1 operator
PDB DOI: 10.2210/pdb4rb3/pdb
Classification: METAL BINDING PROTEIN/DNA Organism(s): Plantago Major , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-09-12 Deposition Author(s): Chen, Z. , Deng, Z.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family) | C | 145 | Plantago Major , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTSGGDSDDK |
DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family) | D | 145 | Plantago Major , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPLTSGGDSDDK |
Method: X-RAY DIFFRACTION