The crystal structure of a cren7 mutant protein gr and dsdna complex
PDB DOI: 10.2210/pdb4r55/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Sulfolobus Solfataricus P2 , Synthetic Construct
Deposited: 2014-08-20 Deposition Author(s): Chen, Y.Y. , Gong, Y. , Huang, L. , Li, H.B. , Zhang, Z.F.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
The crystal structure of a cren7 mutant protein gr and dsdna complex
Chen, Y.Y. , Gong, Y. , Huang, L. , Li, H.B. , Zhang, Z.F.
Primary Citation of Related Structures: 4R55
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromatin protein Cren7 | A | 55 | Sulfolobus Solfataricus P2 , Synthetic Construct | MSSGKKPVKVKTPAGKEAELVPEKVWALGRVKIGLFKDPETGKYFRHKLPDDYPI |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-08-20 Deposition Author(s): Chen, Y.Y. , Gong, Y. , Huang, L. , Li, H.B. , Zhang, Z.F.