Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with msp2 11-23
PDB DOI: 10.2210/pdb4r3s/pdb
Classification: IMMUNE SYSTEM Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2014-08-18 Deposition Author(s): Anders, R.F. , Bankala, K. , Christ, D. , Drinkwater, N. , Macraild, C.A. , Mcgowan, S. , Morales, R.A.V. , Norton, R.S. , Rouet, R. , Seow, J.
Crystal structure of anti-msp2 fv fragment (mab6d8)in complex with msp2 11-23
Anders, R.F. , Bankala, K. , Christ, D. , Drinkwater, N. , Macraild, C.A. , Mcgowan, S. , Morales, R.A.V. , Norton, R.S. , Rouet, R. , Seow, J.
Primary Citation of Related Structures: 4R3S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FV FRAGMENT(MAB6D8) HEAVY CHAIN | A | 114 | Mus Musculus , Synthetic Construct | QVQLQQSGDELVKPGASVKLSCTVSGFNIKDDFIHWMKQRPEQGLEWIGRIDPANGYTKYAPKFQDKATMTADTSSNTAYLQLSSLASEDAAVYYCATYGVAYWGQGTLVTVSA |
| FV FRAGMENT(MAB6D8) LIGHT CHAIN | B | 111 | Mus Musculus , Synthetic Construct | DIVLTQSPASLAVSLGQRATISCKASQSVDHDGDSYMNWFQQKPGQSPKLLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQTNEDPYTFGGGTKLEIK |
| Merozoite surface protein | Q | 15 | Mus Musculus , Synthetic Construct | XFINNAYNMSIRRSX |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-08-18 Deposition Author(s): Anders, R.F. , Bankala, K. , Christ, D. , Drinkwater, N. , Macraild, C.A. , Mcgowan, S. , Morales, R.A.V. , Norton, R.S. , Rouet, R. , Seow, J.