Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with rapamycin
PDB DOI: 10.2210/pdb4qt2/pdb
Classification: ISOMERASE Organism(s): Plasmodium Falciparum 3D7
Deposited: 2014-07-07 Deposition Author(s): Allemand, F. , Bell, A. , Bianchin, A. , Chubb, A.J. , Guichou, J.-F.
Method: X-RAY DIFFRACTION Resolution: 1.44 Å
Crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with rapamycin
Allemand, F. , Bell, A. , Bianchin, A. , Chubb, A.J. , Guichou, J.-F.
Primary Citation of Related Structures: 4QT2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FK506-binding protein (FKBP)-type peptidyl-propyl isomerase | A | 131 | Plasmodium Falciparum 3D7 | FEKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKFHLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRELETSHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-07-07 Deposition Author(s): Allemand, F. , Bell, A. , Bianchin, A. , Chubb, A.J. , Guichou, J.-F.