Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) in complex with 3'-deoxy thymidine
PDB DOI: 10.2210/pdb4qsx/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2014-07-06 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A.M. , Felletar, I. , Knapp, S. , Structural Genomics Consortium (Sgc) , Von Delft, F.
Method: X-RAY DIFFRACTION Resolution: 1.93 Å
Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) in complex with 3'-deoxy thymidine
Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A.M. , Felletar, I. , Knapp, S. , Structural Genomics Consortium (Sgc) , Von Delft, F.
Primary Citation of Related Structures: 4QSX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATPase family AAA domain-containing protein 2 | A | 130 | Homo Sapiens | SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-07-06 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Chaikuad, A. , Edwards, A.M. , Felletar, I. , Knapp, S. , Structural Genomics Consortium (Sgc) , Von Delft, F.