4QR9
Crystal structure of two hmgb1 box a domains cooperating to underwind and kink a dna
PDB DOI: 10.2210/pdb4qr9/pdb
Classification: DNA BINDING PROTEIN Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-06-30 Deposition Author(s): Acosta-Reyes, F.J. , Campos, J.L. , Churchill, M.E.A. , Malarkey, C.S. , Sanchez-Giraldo, R. , Saperas, N.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of two hmgb1 box a domains cooperating to underwind and kink a dna
Acosta-Reyes, F.J. , Campos, J.L. , Churchill, M.E.A. , Malarkey, C.S. , Sanchez-Giraldo, R. , Saperas, N.
Primary Citation of Related Structures: 4QR9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| High mobility group protein B1 | A | 76 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPP |
| High mobility group protein B1 | B | 76 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPP |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | c | 10 | NA | ATATCGATAT |
| DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | d | 10 | NA | ATATCGATAT |
| DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | e | 10 | NA | ATATCGATAT |
| DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | f | 10 | NA | ATATCGATAT |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-30 Deposition Author(s): Acosta-Reyes, F.J. , Campos, J.L. , Churchill, M.E.A. , Malarkey, C.S. , Sanchez-Giraldo, R. , Saperas, N.