Cw-type zinc finger of morc3 in complex with the amino terminus of histone h3
PDB DOI: 10.2210/pdb4qq4/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-06-26 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Cw-type zinc finger of morc3 in complex with the amino terminus of histone h3
Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.
Primary Citation of Related Structures: 4QQ4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MORC family CW-type zinc finger protein 3 | A | 62 | Homo Sapiens , Synthetic Construct | GEDIQKRPDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHP |
| MORC family CW-type zinc finger protein 3 | B | 62 | Homo Sapiens , Synthetic Construct | GEDIQKRPDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHP |
| Histone H3.3 | C | 16 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKAX |
| Histone H3.3 | D | 16 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKAX |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-26 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.