PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

4QQ4

Cw-type zinc finger of morc3 in complex with the amino terminus of histone h3

PDB DOI: 10.2210/pdb4qq4/pdb

Classification: METAL BINDING PROTEIN
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2014-06-26
Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.75 Å

Literature

Cw-type zinc finger of morc3 in complex with the amino terminus of histone h3

Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.

Primary Citation of Related Structures: 4QQ4


Proteins
Molecule Chains Sequence Length Organism Sequence
MORC family CW-type zinc finger protein 3 A 62 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GEDIQKRPDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHP
MORC family CW-type zinc finger protein 3 B 62 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GEDIQKRPDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHP
Histone H3.3 C 16 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ARTKQTARKSTGGKAX
Histone H3.3 D 16 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) ARTKQTARKSTGGKAX
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2014-06-26
Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.