Mechanistic basis of plasmid-specific dna binding of the f plasmid regulatory protein, tram
PDB DOI: 10.2210/pdb4qpq/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Escherichia Coli , Synthetic Construct
Deposited: 2014-06-24 Deposition Author(s): Edwards, R.A. , Frost, L.S. , Glover, J.N.M. , Lu, J. , Peng, Y. , Wong, J.
Mechanistic basis of plasmid-specific dna binding of the f plasmid regulatory protein, tram
Edwards, R.A. , Frost, L.S. , Glover, J.N.M. , Lu, J. , Peng, Y. , Wong, J.
Primary Citation of Related Structures: 4QPQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Relaxosome protein TraM | A | 53 | Escherichia Coli , Synthetic Construct | AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM |
| Relaxosome protein TraM | B | 53 | Escherichia Coli , Synthetic Construct | AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM |
| Relaxosome protein TraM | C | 53 | Escherichia Coli , Synthetic Construct | AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM |
| Relaxosome protein TraM | D | 53 | Escherichia Coli , Synthetic Construct | AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM |
| Relaxosome protein TraM | E | 53 | Escherichia Coli , Synthetic Construct | AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM |
| Relaxosome protein TraM | F | 53 | Escherichia Coli , Synthetic Construct | AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM |
| Relaxosome protein TraM | G | 53 | Escherichia Coli , Synthetic Construct | AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM |
| Relaxosome protein TraM | H | 53 | Escherichia Coli , Synthetic Construct | AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-24 Deposition Author(s): Edwards, R.A. , Frost, L.S. , Glover, J.N.M. , Lu, J. , Peng, Y. , Wong, J.