Structural and catalytic effects of proline substitution and surface loop deletion in the extended active site of human carbonic anhydrase ii - k170p
PDB DOI: 10.2210/pdb4qk1/pdb
Classification: LYASE Organism(s): Homo Sapiens
Deposited: 2014-06-05 Deposition Author(s): Boone, C.D. , Mckenna, R. , Rasi, V.
Structural and catalytic effects of proline substitution and surface loop deletion in the extended active site of human carbonic anhydrase ii - k170p
Boone, C.D. , Mckenna, R. , Rasi, V.
Primary Citation of Related Structures: 4QK1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carbonic anhydrase 2 | A | 260 | Homo Sapiens | MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTPGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-06-05 Deposition Author(s): Boone, C.D. , Mckenna, R. , Rasi, V.