Crystal structure of human baz2a phd zinc finger in the free form
PDB DOI: 10.2210/pdb4qf2/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2014-05-19 Deposition Author(s): Chirgadze, D.Y. , Ciulli, A. , Overvoorde, L. , Tallant, C. , Van Molle, I.
Crystal structure of human baz2a phd zinc finger in the free form
Chirgadze, D.Y. , Ciulli, A. , Overvoorde, L. , Tallant, C. , Van Molle, I.
Primary Citation of Related Structures: 4QF2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bromodomain adjacent to zinc finger domain protein 2A | A | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | B | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | C | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Bromodomain adjacent to zinc finger domain protein 2A | D | 58 | Homo Sapiens | HMSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQV |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-05-19 Deposition Author(s): Chirgadze, D.Y. , Ciulli, A. , Overvoorde, L. , Tallant, C. , Van Molle, I.