Crystal structure of brd2(bd2) mutant with ligand me bound (methyl (2r)- 2-[(4s)-6-(4-chlorophenyl)-8-methoxy-1-methyl-4h-[1,2,4]triazolo[4,3-a][1, 4]benzodiazepin-4-yl]propanoate)
PDB DOI: 10.2210/pdb4qev/pdb
Classification: transcription/transcription inhibitor Organism(s): Homo Sapiens
Deposited: 2014-05-19 Deposition Author(s): Baud, M. , Chirgadze, D.Y. , Ciulli, A. , Lin-Shiao, E. , Tallant, C.
Crystal structure of brd2(bd2) mutant with ligand me bound (methyl (2r)- 2-[(4s)-6-(4-chlorophenyl)-8-methoxy-1-methyl-4h-[1,2,4]triazolo[4,3-a][1, 4]benzodiazepin-4-yl]propanoate)
Baud, M. , Chirgadze, D.Y. , Ciulli, A. , Lin-Shiao, E. , Tallant, C.
Primary Citation of Related Structures: 4QEV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 2 | A | 114 | Homo Sapiens | SMGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGAHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-05-19 Deposition Author(s): Baud, M. , Chirgadze, D.Y. , Ciulli, A. , Lin-Shiao, E. , Tallant, C.