Crystal structure of the complex of phospholipase a2 with p-coumaric acid at 1.2 a resolution
PDB DOI: 10.2210/pdb4qem/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Daboia Russellii Pulchella
Deposited: 2014-05-17 Deposition Author(s): Kaur, P. , Sharma, S. , Shukla, P.K. , Singh, T.P. , Sinha, M. , Tiwari, P.
Crystal structure of the complex of phospholipase a2 with p-coumaric acid at 1.2 a resolution
Kaur, P. , Sharma, S. , Shukla, P.K. , Singh, T.P. , Sinha, M. , Tiwari, P.
Primary Citation of Related Structures: 4QEM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phospholipase A2 VRV-PL-VIIIa | A | 121 | Daboia Russellii Pulchella | SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-05-17 Deposition Author(s): Kaur, P. , Sharma, S. , Shukla, P.K. , Singh, T.P. , Sinha, M. , Tiwari, P.