Cftr associated ligand (cal) pdz bound to biotinylated peptide bt-l-ical36
PDB DOI: 10.2210/pdb4q6s/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-04-23 Deposition Author(s): Amacher, J.F. , Madden, D.R.
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Cftr associated ligand (cal) pdz bound to biotinylated peptide bt-l-ical36
Primary Citation of Related Structures: 4Q6S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| BT-L-iCAL36 peptide | C | 16 | Homo Sapiens , Synthetic Construct | XWRFKKANSRLPTSII |
| BT-L-iCAL36 peptide | D | 16 | Homo Sapiens , Synthetic Construct | XWRFKKANSRLPTSII |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-04-23 Deposition Author(s): Amacher, J.F. , Madden, D.R.