Crystal structure of human adenovirus 8 protease with a nitrile inhibitor
PDB DOI: 10.2210/pdb4piq/pdb
Classification: Hydrolase/Hydrolase inhibitor Organism(s): Human Adenovirus 8 , Synthetic Construct
Deposited: 2014-05-09 Deposition Author(s): Altmann, E. , Bernardi, A. , Combrink, K. , Ellis, D. , Erbel, P. , Grosche, P. , Hughes, N. , Jarousse, N. , Mac Sweeney, A. , Melkko, S. , Ramage, P. , Sirockin, F.
Crystal structure of human adenovirus 8 protease with a nitrile inhibitor
Altmann, E. , Bernardi, A. , Combrink, K. , Ellis, D. , Erbel, P. , Grosche, P. , Hughes, N. , Jarousse, N. , Mac Sweeney, A. , Melkko, S. , Ramage, P. , Sirockin, F.
Primary Citation of Related Structures: 4PIQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 204 | Human Adenovirus 8 , Synthetic Construct | SGSSEQELAAIVRDLGCGPYFLGTHDKRFPGFLAGNKLACAIVNTAGRETGGVHWLAFGWNPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALALSPDRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLLTGVPNGMLQSPQVLPTLRRNQEKLYRFLAHHSPYFRSHRAAIEHATAFDKMKQL |
| PVI | B | 11 | Human Adenovirus 8 , Synthetic Construct | GVKSLKRRRCY |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-05-09 Deposition Author(s): Altmann, E. , Bernardi, A. , Combrink, K. , Ellis, D. , Erbel, P. , Grosche, P. , Hughes, N. , Jarousse, N. , Mac Sweeney, A. , Melkko, S. , Ramage, P. , Sirockin, F.