Grb2 sh2 complexed with a ptyr-ac6cn-asn tripeptide
PDB DOI: 10.2210/pdb4p9v/pdb
Classification: Signaling Protein/Antagonist Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-04-06 Deposition Author(s): Clements, J.H. , Martin, S.F.
Grb2 sh2 complexed with a ptyr-ac6cn-asn tripeptide
Primary Citation of Related Structures: 4P9V
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Growth factor receptor-bound protein 2 | A | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH |
PHQ-PTR-02K-ASN-NH2 | B | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XYANX |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-04-06 Deposition Author(s): Clements, J.H. , Martin, S.F.