Crystal structure of kaposi's sarcoma-associated herpesvirus (kshv) protease in complex with a dimer disruptor
PDB DOI: 10.2210/pdb4p2t/pdb
Classification: HYDROLASE Organism(s): Human Herpesvirus 8
Deposited: 2014-03-04 Deposition Author(s): Gable, J.E.
Crystal structure of kaposi's sarcoma-associated herpesvirus (kshv) protease in complex with a dimer disruptor
Primary Citation of Related Structures: 4P2T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| KSHV Protease | A | 194 | Human Herpesvirus 8 | QGLYVGGFVDVVSCPKLEQELYLDPDQVTDYLPVTEPLPITIEHLPETEVGWTLGLFQVSHGIFCTGAITSPAFLELASRLADTSHVARAPVKNLPKEPLLEILHTWLPGLSLSSIHPRELSQTPSGPVFQHVSLCALGRRRGTVAVYGHDAEWVVSRFSSVSKSERAHILQHVSSCRLEDLSTPNFVSPLETL |
| KSHV Protease | B | 194 | Human Herpesvirus 8 | QGLYVGGFVDVVSCPKLEQELYLDPDQVTDYLPVTEPLPITIEHLPETEVGWTLGLFQVSHGIFCTGAITSPAFLELASRLADTSHVARAPVKNLPKEPLLEILHTWLPGLSLSSIHPRELSQTPSGPVFQHVSLCALGRRRGTVAVYGHDAEWVVSRFSSVSKSERAHILQHVSSCRLEDLSTPNFVSPLETL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-03-04 Deposition Author(s): Gable, J.E.