Crystal structure of nherf2 pdz1 domain in complex with lpa2
PDB DOI: 10.2210/pdb4p0c/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2014-02-20 Deposition Author(s): Brunzelle, J. , Holcomb, J. , Jiang, Y. , Li, C. , Lu, G. , Naren, A. , Sirinupong, N. , Trescott, L. , Yang, Z.
Crystal structure of nherf2 pdz1 domain in complex with lpa2
Brunzelle, J. , Holcomb, J. , Jiang, Y. , Li, C. , Lu, G. , Naren, A. , Sirinupong, N. , Trescott, L. , Yang, Z.
Primary Citation of Related Structures: 4P0C
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Na(+)/H(+) exchange regulatory cofactor NHE-RF2/Lysophosphatidic acid receptor 2 chimeric protein | A | 88 | Salmonella Enterica | MPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQMDSTL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-02-20 Deposition Author(s): Brunzelle, J. , Holcomb, J. , Jiang, Y. , Li, C. , Lu, G. , Naren, A. , Sirinupong, N. , Trescott, L. , Yang, Z.