Crystal structure of the helicobacter pylori mtan-d198n mutant with s-adenosylhomocysteine in the active site
PDB DOI: 10.2210/pdb4oy3/pdb
Classification: HYDROLASE Organism(s): Helicobacter Pylori
Deposited: 2014-02-10 Deposition Author(s): Mishra, V. , Ronning, D.R.
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Crystal structure of the helicobacter pylori mtan-d198n mutant with s-adenosylhomocysteine in the active site
Primary Citation of Related Structures: 4OY3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Aminodeoxyfutalosine nucleosidase | A | 231 | Helicobacter Pylori | MGQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISNNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-02-10 Deposition Author(s): Mishra, V. , Ronning, D.R.