Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutation in complex with boron-based inhibitor ec25
PDB DOI: 10.2210/pdb4oq0/pdb
Classification: hydrolase/hydrolase inhibitor Organism(s): Escherichia Coli
Deposited: 2014-02-07 Deposition Author(s): Dellus-Gur, E. , Elias, M. , Fraser, J.S. , Tawfik, D.S.
Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutation in complex with boron-based inhibitor ec25
Dellus-Gur, E. , Elias, M. , Fraser, J.S. , Tawfik, D.S.
Primary Citation of Related Structures: 4OQ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TEM-94 ES-beta-lactamase | A | 263 | Escherichia Coli | HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-02-07 Deposition Author(s): Dellus-Gur, E. , Elias, M. , Fraser, J.S. , Tawfik, D.S.