Crystal structure of the c-src tyrosine kinase sh3 domain mutant q128e
PDB DOI: 10.2210/pdb4omo/pdb
Classification: TRANSFERASE Organism(s): Caldanaerobius
Deposited: 2014-01-27 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.
Crystal structure of the c-src tyrosine kinase sh3 domain mutant q128e
Bacarizo, J. , Camara-Artigas, A.
Primary Citation of Related Structures: 4OMO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 61 | Caldanaerobius | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPSD |
Proto-oncogene tyrosine-protein kinase Src | B | 61 | Caldanaerobius | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-01-27 Deposition Author(s): Bacarizo, J. , Camara-Artigas, A.