Structure of slyd delta-if from thermus thermophilus in complex with fk506
PDB DOI: 10.2210/pdb4odr/pdb
Classification: ISOMERASE, CHAPERONE Organism(s): Homo Sapiens , Thermus Thermophilus
Deposited: 2014-01-10 Deposition Author(s): Low, C. , Nordlund, P. , Quistgaard, E.M.
Structure of slyd delta-if from thermus thermophilus in complex with fk506
Low, C. , Nordlund, P. , Quistgaard, E.M.
Primary Citation of Related Structures: 4ODR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl cis-trans isomerase FKBP1A chimera | A | 110 | Homo Sapiens , Thermus Thermophilus | MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH |
Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl cis-trans isomerase FKBP1A chimera | B | 110 | Homo Sapiens , Thermus Thermophilus | MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-01-10 Deposition Author(s): Low, C. , Nordlund, P. , Quistgaard, E.M.