Structure of slyd delta-if from thermus thermophilus in complex with s3 peptide
PDB DOI: 10.2210/pdb4odq/pdb
Classification: ISOMERASE, CHAPERONE Organism(s): Homo Sapiens , Thermus Thermophilus , Synthetic Construct
Deposited: 2014-01-10 Deposition Author(s): Low, C. , Nordlund, P. , Quistgaard, E.M.
Structure of slyd delta-if from thermus thermophilus in complex with s3 peptide
Low, C. , Nordlund, P. , Quistgaard, E.M.
Primary Citation of Related Structures: 4ODQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl cis-trans isomerase FKBP1A chimera | A | 110 | Homo Sapiens , Thermus Thermophilus , Synthetic Construct | MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH |
30S ribosomal protein S3 | B | 16 | Homo Sapiens , Thermus Thermophilus , Synthetic Construct | RLGIVKPWNSTWFANX |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-01-10 Deposition Author(s): Low, C. , Nordlund, P. , Quistgaard, E.M.