4ODP
Structure of slyd delta-if from thermus thermophilus in complex with s2-w23a peptide
PDB DOI: 10.2210/pdb4odp/pdb
Classification: ISOMERASE, CHAPERONE Organism(s): Salmonella Enterica , Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-01-10 Deposition Author(s): Low, C. , Nordlund, P. , Quistgaard, E.M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.747 Å
Structure of slyd delta-if from thermus thermophilus in complex with s2-w23a peptide
Low, C. , Nordlund, P. , Quistgaard, E.M.
Primary Citation of Related Structures: 4ODP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl cis-trans isomerase FKBP1A chimera | A | 110 | Salmonella Enterica , Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH |
| 30S ribosomal protein S2 | B | 16 | Salmonella Enterica , Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TRYANPKMKPFIFGAX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-01-10 Deposition Author(s): Low, C. , Nordlund, P. , Quistgaard, E.M.