4ODK
Structure of slyd from thermus thermophilus in complex with t1 peptide
PDB DOI: 10.2210/pdb4odk/pdb
Classification: ISOMERASE, CHAPERONE Organism(s): Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-01-10 Deposition Author(s): Low, C. , Nordlund, P. , Quistgaard, E.M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.401 Å
Structure of slyd from thermus thermophilus in complex with t1 peptide
Low, C. , Nordlund, P. , Quistgaard, E.M.
Primary Citation of Related Structures: 4ODK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase SlyD | A | 158 | Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH |
| Guanyl-specific ribonuclease T1 | B | 16 | Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | VGSNSYPHKYNNYEGX |
| Guanyl-specific ribonuclease T1 | C | 16 | Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | VGSNSYPHKYNNYEGX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2014-01-10 Deposition Author(s): Low, C. , Nordlund, P. , Quistgaard, E.M.