Structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked
PDB DOI: 10.2210/pdb4od6/pdb
Classification: HYDROLASE Organism(s): Deinococcus Radiodurans
Deposited: 2014-01-10 Deposition Author(s): Hua, Y.J. , Xu, Q. , Zhang, H. , Zhao, Y.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Endonuclease MutS2 | A | 90 | Deinococcus Radiodurans | GHMGSAPSRFDNELQLRGLSVEAAVEELRAAIAEARALKETPLRVVHGKGMGVLRRTLRDYLKTDKNVESFHDAEANQGGHGVTIVNVKR |
Method: X-RAY DIFFRACTION