Crystal structure of inactive hiv-1 protease in complex with the p1-p6 substrate variant (s451n)
PDB DOI: 10.2210/pdb4obj/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus Type 1 , Synthetic Construct
Deposited: 2014-01-07 Deposition Author(s): Kolli, M.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 Protease | A | 99 | Human Immunodeficiency Virus Type 1 , Synthetic Construct | PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| HIV-1 Protease | B | 99 | Human Immunodeficiency Virus Type 1 , Synthetic Construct | PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| p1-p6 peptide | C | 10 | Human Immunodeficiency Virus Type 1 , Synthetic Construct | RPGNFLQNRP |
Method: X-RAY DIFFRACTION
Deposited Date: 2014-01-07 Deposition Author(s): Kolli, M.