Saicar synthetase (type-2) in complex with ump/udp
PDB DOI: 10.2210/pdb4o7r/pdb
Classification: LIGASE Organism(s): Pyrococcus Horikoshii
Deposited: 2013-12-26 Deposition Author(s): Jeyakanthan, J. , Manjunath, K. , Sekar, K.
Saicar synthetase (type-2) in complex with ump/udp
Jeyakanthan, J. , Manjunath, K. , Sekar, K.
Primary Citation of Related Structures: 4O7R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phosphoribosylaminoimidazole-succinocarboxamide synthase | A | 238 | Pyrococcus Horikoshii | MVKLMEVYEGKAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-12-26 Deposition Author(s): Jeyakanthan, J. , Manjunath, K. , Sekar, K.