Crystal structure of smarcal1 harp substrate recognition domain
PDB DOI: 10.2210/pdb4o66/pdb
Classification: DNA BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 2013-12-20 Deposition Author(s): Eichman, B.F. , Mason, A.C.
Crystal structure of smarcal1 harp substrate recognition domain
Primary Citation of Related Structures: 4O66
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 | A | 76 | Mus Musculus | GPGSPQNTGFLRGACIKTGDRFRVKIGYNQELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPL |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 | B | 76 | Mus Musculus | GPGSPQNTGFLRGACIKTGDRFRVKIGYNQELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPL |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 | C | 76 | Mus Musculus | GPGSPQNTGFLRGACIKTGDRFRVKIGYNQELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPL |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 | D | 76 | Mus Musculus | GPGSPQNTGFLRGACIKTGDRFRVKIGYNQELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPL |
Method: X-RAY DIFFRACTION
Deposited Date: 2013-12-20 Deposition Author(s): Eichman, B.F. , Mason, A.C.